Loading...
Statistics
Advertisement

www.gasnonprofit.org
www.gasnonprofit.org/

Gasnonprofit.org

Advertisement
Gasnonprofit.org is hosted in United States / Houston . Gasnonprofit.org doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: CSS, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.5.

Technologies in use by Gasnonprofit.org

Technology

Number of occurences: 1
  • CSS

Advertisement

Server Type

  • Microsoft-IIS/7.5

Powered by

  • ASP.NET

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Gasnonprofit.org

Missing HTTPS protocol.

    Meta - Gasnonprofit.org

    Number of occurences: 0

    Server / Hosting

    • IP: 108.167.135.120
    • Latitude: 29.83
    • Longitude: -95.47
    • Country: United States
    • City: Houston

    Rname

    • ns1.mdnsservice.com
    • ns2.mdnsservice.com
    • ns3.mdnsservice.com
    • mx.gasnonprofit.org

    Target

    • hostmaster.mdnsservice.com

    HTTP Header Response

    HTTP/1.1 200 OK Pragma: no-cache Content-Type: text/html Expires: 0 Server: Microsoft-IIS/7.5 X-Powered-By: ASP.NET Set-Cookie: BASEREFERER=referrerless; expires=Monday, 12-Dec-2016 17:48:11 GMT; path=/; domain=.gasnonprofit.org Set-Cookie: SIGNUPEARCODE=REFERERLESS; expires=Monday, 12-Dec-2016 17:48:11 GMT; path=/; domain=.gasnonprofit.org Set-Cookie: phsViewerID=23.104.184.118.1473788891.13601; expires=Wednesday, 13-Sep-2017 17:48:11 GMT; path=/; domain=.gasnonprofit.org Date: Tue, 13 Sep 2016 17:48:11 GMT Content-Length: 1005 X-Cache: MISS from s_ub9 Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive

    DNS

    host: gasnonprofit.org
    1. class: IN
    2. ttl: 300
    3. type: A
    4. ip: 216.40.47.17
    host: gasnonprofit.org
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns1.mdnsservice.com
    host: gasnonprofit.org
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns2.mdnsservice.com
    host: gasnonprofit.org
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns3.mdnsservice.com
    host: gasnonprofit.org
    1. class: IN
    2. ttl: 300
    3. type: SOA
    4. mname: ns1.mdnsservice.com
    5. rname: hostmaster.mdnsservice.com
    6. serial: 1556816425
    7. refresh: 10001
    8. retry: 7200
    9. expire: 2419200
    10. minimum-ttl: 86400
    host: gasnonprofit.org
    1. class: IN
    2. ttl: 300
    3. type: MX
    4. pri: 10
    5. target: mx.gasnonprofit.org
    host: gasnonprofit.org
    1. class: IN
    2. ttl: 300
    3. type: TXT
    4. txt: v=spf1 ip4:38.113.1.0/24 ip4:38.113.20.0/24 ip4:65.254.224.0/19 ?all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.asnonprofit.org, www.gsasnonprofit.org, www.sasnonprofit.org, www.gxasnonprofit.org, www.xasnonprofit.org, www.gyasnonprofit.org, www.yasnonprofit.org, www.ghasnonprofit.org, www.hasnonprofit.org, www.gnasnonprofit.org, www.nasnonprofit.org, www.gcasnonprofit.org, www.casnonprofit.org, www.gdasnonprofit.org, www.dasnonprofit.org, www.geasnonprofit.org, www.easnonprofit.org, www.grasnonprofit.org, www.rasnonprofit.org, www.gtasnonprofit.org, www.tasnonprofit.org, www.gbasnonprofit.org, www.basnonprofit.org, www.gvasnonprofit.org, www.vasnonprofit.org, www.gsnonprofit.org, www.gaosnonprofit.org, www.gosnonprofit.org, www.gapsnonprofit.org, www.gpsnonprofit.org, www.ga9snonprofit.org, www.g9snonprofit.org, www.gasnonprofit.org, www.gsnonprofit.org, www.gaisnonprofit.org, www.gisnonprofit.org, www.gausnonprofit.org, www.gusnonprofit.org, www.ganonprofit.org, www.gasenonprofit.org, www.gaenonprofit.org, www.gaswnonprofit.org, www.gawnonprofit.org, www.gasdnonprofit.org, www.gadnonprofit.org, www.gasxnonprofit.org, www.gaxnonprofit.org, www.gasfnonprofit.org, www.gafnonprofit.org, www.gasgnonprofit.org, www.gagnonprofit.org, www.gastnonprofit.org, www.gatnonprofit.org, www.gasonprofit.org, www.gasnnonprofit.org, www.gasnonprofit.org, www.gasnhonprofit.org, www.gashonprofit.org, www.gasnjonprofit.org, www.gasjonprofit.org, www.gasnkonprofit.org, www.gaskonprofit.org, www.gasnlonprofit.org, www.gaslonprofit.org, www.gasn onprofit.org, www.gas onprofit.org, www.gasnnprofit.org, www.gasnobnprofit.org, www.gasnbnprofit.org, www.gasnohnprofit.org, www.gasnhnprofit.org, www.gasnognprofit.org, www.gasngnprofit.org, www.gasnojnprofit.org, www.gasnjnprofit.org, www.gasnomnprofit.org, www.gasnmnprofit.org, www.gasno nprofit.org, www.gasn nprofit.org, www.gasnovnprofit.org, www.gasnvnprofit.org, www.gasnoprofit.org, www.gasnonnprofit.org, www.gasnonprofit.org, www.gasnonhprofit.org, www.gasnohprofit.org, www.gasnonjprofit.org, www.gasnojprofit.org, www.gasnonkprofit.org, www.gasnokprofit.org, www.gasnonlprofit.org, www.gasnolprofit.org, www.gasnon profit.org, www.gasno profit.org, www.gasnonrofit.org, www.gasnonpirofit.org, www.gasnonirofit.org, www.gasnonpkrofit.org, www.gasnonkrofit.org, www.gasnonpurofit.org, www.gasnonurofit.org, www.gasnonpjrofit.org, www.gasnonjrofit.org, www.gasnonplrofit.org, www.gasnonlrofit.org, www.gasnonpofit.org, www.gasnonpriofit.org, www.gasnonpiofit.org, www.gasnonproofit.org, www.gasnonpoofit.org, www.gasnonprlofit.org, www.gasnonplofit.org, www.gasnonprlofit.org, www.gasnonplofit.org, www.gasnonpr.ofit.org, www.gasnonp.ofit.org, www.gasnonprfit.org, www.gasnonprobfit.org, www.gasnonprbfit.org, www.gasnonprohfit.org, www.gasnonprhfit.org, www.gasnonprogfit.org, www.gasnonprgfit.org, www.gasnonprojfit.org, www.gasnonprjfit.org, www.gasnonpromfit.org, www.gasnonprmfit.org, www.gasnonpro fit.org, www.gasnonpr fit.org, www.gasnonprovfit.org, www.gasnonprvfit.org, www.gasnonproit.org, www.gasnonprofqit.org, www.gasnonproqit.org, www.gasnonprofit.org, www.gasnonproit.org, www.gasnonprofait.org, www.gasnonproait.org, www.gasnonprofyit.org, www.gasnonproyit.org, www.gasnonproftit.org, www.gasnonprotit.org, www.gasnonprofgit.org, www.gasnonprogit.org, www.gasnonprofbit.org, www.gasnonprobit.org, www.gasnonprofwit.org, www.gasnonprowit.org, www.gasnonprofsit.org, www.gasnonprosit.org, www.gasnonprofdit.org, www.gasnonprodit.org, www.gasnonprofrit.org, www.gasnonprorit.org, www.gasnonprof3it.org, www.gasnonpro3it.org, www.gasnonprof4it.org, www.gasnonpro4it.org, www.gasnonproft.org, www.gasnonprofirt.org, www.gasnonprofrt.org, www.gasnonprofift.org, www.gasnonprofft.org, www.gasnonprofivt.org, www.gasnonprofvt.org, www.gasnonprofikt.org, www.gasnonprofkt.org, www.gasnonprofi,t.org, www.gasnonprof,t.org, www.gasnonprofibt.org, www.gasnonprofbt.org, www.gasnonprofigt.org, www.gasnonprofgt.org, www.gasnonprofitt.org, www.gasnonproftt.org, www.gasnonprofiyt.org, www.gasnonprofyt.org, www.gasnonprofiut.org, www.gasnonprofut.org, www.gasnonprofijt.org, www.gasnonprofjt.org, www.gasnonprofimt.org, www.gasnonprofmt.org, www.gasnonprofint.org, www.gasnonprofnt.org,

    Other websites we recently analyzed

    1. Jak można schudnąć z zielonym jęczmieniem? Tabletki jęczmień bio!
      Poland - 188.116.9.209
      Server software: Apache
      Technology: BootstrapCDN, Maxcdn, AJAX Libraries API, CSS, Html, Html5, Javascript, Yandex.Metrika
      Number of Javascript: 2
      Number of meta tags: 6
    2. Busch & Endres GmbH - Ihr Partner für ein intelligentes Zuhause!
      Busch & Endres GmbH – Experte für Smart Home, Hausautomatisierung, individuelle Multiroom Installation, Lichtkonzepte und elektrische Haussteuerung.
      Germany - 87.106.122.198
      G Analytics ID: UA-51678759-1
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, Google Analytics, Facebook Box
      Number of Javascript: 1
      Number of meta tags: 4
    3. YSG EMLAK | Edremit | Burhaniye | Ayvalık | Havran | Gömeç
      Turkey - 213.142.138.4
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Flexslider, Html, Html5, Javascript
      Number of Javascript: 12
      Number of meta tags: 4
    4. Bienvenue
      Voici la page daccueil
      Ashburn (United States) - 23.21.62.221
      Server software: Redirector/1.0
      Technology: DoubleClick.Net, CSS, Html, Iframe, Javascript
      Number of Javascript: 21
      Number of meta tags: 4
    5. arizonarent.com
      Kirkland (United States) - 98.124.245.24
      Server software: Apache
      Technology: Html, Javascript
      Number of Javascript: 1
      Number of meta tags: 1
    6. financialserviceshypermarket.com
      United Kingdom - 62.233.121.61
      Server software: Apache/2.2.15 (CentOS)
      Technology: CSS, Html, Html5, Javascript
      Number of meta tags: 5
    7. daxia.lol
      China - 124.16.31.156
      Server software: Tengine/1.4.2
      Technology: CloudFront, Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1
    8. Hot Water Heater Installs and Repairs
      Rochester (United States) - 104.152.187.98
      Server software: nginx
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 6
      Number of meta tags: 3
    9. feel afraid
      Brea (United States) - 75.119.205.104
      Server software: Apache
      Technology: CSS, Html, Javascript, Php, Google Analytics, Project Wonderful
    10. Material Electrico- Venta online a los mejores precios
      Venta de material eléctrico, telecomunicaciones, iluminación profesional y montajes de cuadros eléctricos.
      France - 149.202.58.250
      G Analytics ID: UA-57275951-1
      Server software: Apache/2.4.10
      Technology: CSS, Flexslider, Google Font API, Html, Html5, Javascript, jQuery, jQuery Cycle, Php, Pingback, SVG, Google Analytics, Wordpress
      Number of Javascript: 18
      Number of meta tags: 7

    Check Other Websites